Welcome to old-web
GBP Currency
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Categories
Cart
0
Product Details
Cooling Fan for HPE ProLiant DL380 Gen9
Cooling Fan for HPE ProLiant DL380 Gen9
Cooling Fan for HPE ProLiant DL380 Gen9
Cooling Fan for HPE ProLiant DL380 Gen9
Cooling Fan for HPE ProLiant DL380 Gen9
Cooling Fan for HPE ProLiant DL380 Gen9

Cooling Fan for HPE ProLiant DL380 Gen9

Product Code: HPECOOLGEN9
Brand: HPE
Product Condition: Refurbished
Units in Stock: 24
weight: 220.0g
£5.39 inc. tax
£4.49 ex. tax
? Tax based on United Kingdom.
 Add to Cart
Description
CPU Cooling Fan for HPE ProLiant DL380 (2U Server).

Compatable with:
    - DL380 Gen9
    - DL380 Gen10
Updating Order Details
Please do not refresh or navigate away from the page!
Reviews
No Reviews Posted Yet - be the first!
write review
Related Products
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i